Shopping security
CD317 Recombinant Protein
Catalogue Number: NCP0356-500, NCP0356-1000
Sizes: 500ug, 1mg
Swiss-Prot: Q10589
Host: E.coli
Tag: His-tag
AA Sequence: MNSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHt VMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Restriction Sites: NdeI-XhoI
Background: BST2 (CD317, Tetherin, HM1.24) is a type II transmembrane glycoprotein functioning as a major mediator of the innate immune defense against the dissemination of enveloped viruses by tethering viron on cell surface. BST2 has a N-terminal cytoplasmic tail for entocytosis and cytoskelatal signaling, a transmembrane domain, an extracellular domain containing putative disulfide bonds and coiled coil region for forming homodimer, and a C-terminal GPI domain for membran anchoring. Both the transmembrane domain and the GPI domain can insert either to the cell membrane or the viral envelope membrane and hold them together to prevent viral release. Virus counteracts BST2 by encoding viral protein as antagonist. These viral proteins interact directly with BST2 to either enhance BST2 endocytosis/lysosomal degradation (such as Vpu) or prevent BST2 secretion pathway by sequestering the protein in endosome. BST2 is overexpressed in gastrointestinal cancers, breast cancer, lung cancer and multiple myeloma. BST2 monoclonal antibody targeting myeloma or lung cancer cells induces celllular cytotoxicity and cell death (ADCC, antibody-dependent cell-mediated cytotoxicity). Thus BST2 serves as a potential target for tumor immunotherapy.
Soluble: PBS, 4M Urea, PH7.4
Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression Vector: pet-22b(+)
BioWorld Molecular Weight: ~16kDa
Notes: For research use only, not for use in diagnostic procedure.
Ships within 48 hours · Estimated delivery Jul 19 - Jul 24
US$40
Get nowSign up to your membership to get coupons up to
15%
Get nowOpportunity to enjoy order discount up to 15% off
Top-Converting Item to Boost Your Average Order